PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0238s00100.1
Common NameLR48_Vigan11g023000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NAC
Protein Properties Length: 339aa    MW: 37885.1 Da    PI: 6.5189
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0238s00100.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.51.1e-52151431128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk
  Vang0238s00100.1  15 VPPGFRFHPTEEELLQYYLRKKVSYEKIDL-DVIRDVDLNKLEPWDIQEKCKIgttPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDK 106
                       69****************************.9***************964444222455********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        ++s +g+ +g++ktLvfykgrap+g+k+dW+mheyrl
  Vang0238s00100.1 107 VIYS-NGKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 143
                       ****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-599175IPR003441NAC domain
PROSITE profilePS5100557.15415175IPR003441NAC domain
PfamPF023659.6E-2816143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MPENMSISVN GQSQVPPGFR FHPTEEELLQ YYLRKKVSYE KIDLDVIRDV DLNKLEPWDI  60
QEKCKIGTTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKVIYS NGKRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDDNTTGD TTIVSNVMGD GGQEEGWVVC RIFKKKNNLK  180
TLDSPLGSGE GRRSHLFESC DEGALEQILQ QMGRGCKEES SYEGSYGYGR LGRGYETGVN  240
NDRFMKLPSL ESPKSTSMES QQNNNSNSNN GDNNNEMNNN GYHPIIPADM GTDNEGSFAT  300
HQVSGGDPNM VHPMEPSSGG GGLTNWAALD RLIGDLKV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4991779170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014524091.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-128NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0L9VQG90.0A0A0L9VQG9_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SZ460.0A0A0S3SZ46_PHAAN; Uncharacterized protein
STRINGGLYMA07G05660.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-115NAC family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]